Detail Information for SPSED0005013

Accession Number SPSED0005013
Secreted Protein α-amylase (AmyE)
Uniprot Accession Number -
GenBank Accession Number -
Source Organism of the Secreted Protein Geobacillus stearothermophilus NBRC 12550
Nucleotide Sequence of the Secreted Protein Length = 1 nt
-
Amino Acid Sequence of the Secreted Protein Length = 1 aa
-
Expression Host Corynebacterium glutamicum

Source Organism of the Signal Peptide Corynebacterium glutamicum R
Source Gene of the Signal Peptide CgR2069
Signal Peptide Sequence Length = 38 aa
LNEVDRGFLKMFGRRWVSVVASCVIASTLILVPSHSGA
Type Sec
Yield 52.5064 (mU/ml)
Performance (Current Yield / Highest Yield) 0.18
Charge 2
Charge (N-Region) 2
Hydrophobicity 0.67
Hydrophobicity Plot
Hydrophobicity (H-region) 2.12
Signal Peptide Original Protein Sequence -
Signal Peptide Original DNA Sequence -
Reference Watanabe K, Tsuchida Y, Okibe N, et al. Scanning the Corynebacterium glutamicum R genome for high-efficiency secretion signal sequences[J]. Microbiology-Sgm, 2009, 155: 741-750. [PubMed]
Miscellaneous -