Detail Information for SPSED0005023

Accession Number SPSED0005023
Secreted Protein α-amylase (AmyE)
Uniprot Accession Number -
GenBank Accession Number -
Source Organism of the Secreted Protein Geobacillus stearothermophilus NBRC 12550
Nucleotide Sequence of the Secreted Protein Length = 1 nt
-
Amino Acid Sequence of the Secreted Protein Length = 1 aa
-
Expression Host Corynebacterium glutamicum

Source Organism of the Signal Peptide Corynebacterium glutamicum R
Source Gene of the Signal Peptide CgR2697
Signal Peptide Sequence Length = 48 aa
VKIKKSASALSRSMRIGIATITSTAMLGGVLVAVPAHPLLPTTAVAQA
Type Sec
Yield 16.0578 (mU/ml)
Performance (Current Yield / Highest Yield) 0.06
Charge 5
Charge (N-Region) 5
Hydrophobicity 0.77
Hydrophobicity Plot
Hydrophobicity (H-region) 1.93
Signal Peptide Original Protein Sequence -
Signal Peptide Original DNA Sequence -
Reference Watanabe K, Tsuchida Y, Okibe N, et al. Scanning the Corynebacterium glutamicum R genome for high-efficiency secretion signal sequences[J]. Microbiology-Sgm, 2009, 155: 741-750. [PubMed]
Miscellaneous -